Human Genome: HGPCR0254

(C) Copyright 2001 M.D.R. Croning

HGPCR0254

(Q9NQN1)

BA327L3.3 OLFACTORY RECEPTOR LIKE PROTEIN

Confirmed by human inspection

GPCR PRINTS Classification

Gene is located on clone: AL135841

Membrane topology: predictions

Signal peptide: prediction

GPCR Fingerprint, profile HMM, and generalised profile matches

SWALL FASTA: search                        Multiple sequence alignment

EMBL PATENT FASTA: search           Multiple sequence alignment

Predicted amino acid sequence (524 residues)

     MELVLLLLLLLEDICLVNHSGSLGLQPGDKVLFPEASTIFVSLTPEGKLRGEPAFLRPGSQILFMKSLELGQQHL
ASTAERNEVRETPPKAKVPTRFKRKKKKEGLPGRLPQMRFPPRPASASRNLPAATGPKQQLLLGQRGAAGLPVPA
GDPMNQVPSLSLLLCPYASPEGAWQGFHPTPQARKGGSEEKRTPSGSGGERQRGYHMEKANETSPVMGFVLLRLS
AHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPMYFFLGNLSFLDICFTTSSVPLVLDSFLTPQETIS
FSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPF
CGDNVINHFTCEILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFSTCSA
HLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLRNKDVKAAVRRLLRPKGFT

Predicted cDNA sequence (1578 base pairs)

     ATGGAGCTTGTGCTGCTGCTGCTGCTGCTGTTGGAAGACATCTGTCTTGTCAACCATTCTGGATCTCTAGGACTT
     CAACCTGGGGACAAGGTGCTCTTCCCTGAAGCGAGCACCATCTTTGTTTCTCTGACACCTGAGGGAAAGCTCAGG
     GGGGAGCCAGCATTTTTGAGGCCAGGAAGCCAGATCCTCTTCATGAAGAGTCTGGAGCTGGGACAGCAGCATTTA
     GCCAGCACAGCTGAAAGGAATGAAGTGAGAGAAACACCACCAAAGGCTAAAGTGCCCACACGATTTAAGAGGAAA
     AAGAAGAAAGAGGGTCTCCCAGGACGTTTGCCTCAGATGCGCTTTCCTCCTCGCCCCGCCTCTGCTTCCAGAAAC
     CTCCCAGCTGCCACTGGTCCTAAGCAGCAGCTGCTGCTGGGGCAGAGAGGAGCTGCTGGGCTCCCAGTGCCCGCC
     GGGGACCCCATGAACCAAGTCCCCTCCCTGTCCTTGCTGCTCTGTCCCTACGCAAGCCCCGAGGGGGCCTGGCAG
     GGCTTCCATCCCACTCCACAGGCGAGGAAGGGAGGCTCAGAGGAAAAGCGGACTCCCTCAGGGTCAGGGGGCGAG
     AGGCAGAGGGGATATCACATGGAAAAAGCCAATGAGACCTCCCCTGTGATGGGGTTCGTTCTCCTGAGGCTCTCT
     GCCCACCCAGAGCTGGAAAAGACATTCTTCGTGCTCATCCTGCTGATGTACCTCGTGATCCTGCTGGGCAATGGG
     GTCCTCATCCTGGTGACCATCCTTGACTCCCGCCTGCACACGCCCATGTACTTCTTCCTAGGGAACCTCTCCTTC
     CTGGACATCTGCTTCACTACCTCCTCAGTCCCACTGGTCCTGGACAGCTTTTTGACTCCCCAGGAAACCATCTCC
     TTCTCAGCCTGTGCTGTGCAGATGGCACTCTCCTTTGCCATGGCAGGAACAGAGTGCTTGCTCCTGAGCATGATG
     GCATTTGATCGCTATGTGGCCATCTGCAACCCCCTTAGGTACTCCGTGATCATGAGCAAGGCTGCCTACATGCCC
     ATGGCTGCCAGCTCCTGGGCTATTGGTGGTGCTGCTTCCGTGGTACACACATCCTTGGCAATTCAGCTGCCCTTC
     TGTGGAGACAATGTCATCAACCACTTCACCTGTGAGATTCTGGCTGTTCTAAAGTTGGCCTGTGCTGACATTTCC
     ATCAATGTGATCAGCATGGAGGTGACGAATGTGATCTTCCTAGGAGTCCCGGTTCTGTTCATCTCTTTCTCCTAT
     GTCTTCATCATCACCACCATCCTGAGGATCCCCTCAGCTGAGGGGAGGAAAAAGGTCTTCTCCACCTGCTCTGCC
     CACCTCACCGTGGTGATCGTCTTCTACGGGACCTTATTCTTCATGTATGGGAAGCCTAAGTCTAAGGACTCCATG
     GGAGCAGACAAAGAGGATCTTTCAGACAAACTCATCCCCCTTTTCTATGGGGTGGTGACCCCGATGCTCAACCCC
     ATCATCTATAGCCTGAGGAACAAGGATGTGAAGGCTGCTGTGAGGAGACTGCTGAGACCAAAAGGCTTCACTCAG
     TGA
Generated by script: Mon Feb 5 10:59:40 2001
Comments to: MDR Croning