Human Genome: HGPCR0339

(C) Copyright 2001 M.D.R. Croning

HGPCR0339

PUTATIVE NOVEL OLFACTORY RECEPTOR

As assessed by human inspection

GPCR PRINTS Classification

Gene is located on clone: AC068339

Membrane topology: predictions

Signal peptide: prediction

GPCR Fingerprint, profile HMM, and generalised profile matches

SWALL FASTA: search                        Multiple sequence alignment

EMBL PATENT FASTA: search           Multiple sequence alignment

Predicted amino acid sequence (309 residues)

     MAGNNFTEVTVFILSGFANHPELQVSLFLMFLFIYLFTVLGNLGLITLIRMDSQLHTPMYFFLSNLAFIDIFYSS
TVTPKALVNFQSNRRSISFVGCFVQMYFFVGLVCCECFLLGSMAYNRYIAICNPLLYSVVMSQKVSNWLGVMPYV
IGFTSSLISVWVISSLAFCDSSINHFFCDTTALLALSCVDTFGTEMVSFVLAGFTLLSSLLIITVTYIIIISAIL
RIQSAAGRQKAFSTCASHLMAVTIFYGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNAL
LRVIHRKLF

Predicted cDNA sequence (933 base pairs)

     ATGGCTGGCAACAATTTCACTGAGGTTACCGTCTTCATCCTCTCTGGATTTGCAAATCACCCTGAATTACAAGTC
     AGTCTTTTCTTGATGTTTCTCTTCATTTATCTATTCACTGTTTTGGGAAACCTGGGACTGATCACGTTAATCAGA
     ATGGATTCTCAGCTTCACACCCCTATGTACTTTTTCCTGAGCAATTTAGCATTTATTGACATATTTTACTCCTCT
     ACTGTAACACCTAAGGCATTGGTGAATTTCCAATCCAATCGGAGATCCATCTCCTTTGTTGGCTGCTTTGTTCAA
     ATGTACTTTTTTGTTGGATTGGTGTGTTGTGAGTGTTTCCTTCTGGGATCAATGGCCTACAATCGCTACATAGCA
     ATCTGCAATCCCTTACTGTATTCAGTAGTCATGTCCCAAAAAGTGTCCAACTGGCTGGGAGTAATGCCATATGTG
     ATAGGCTTCACAAGCTCGCTGATATCTGTCTGGGTGATAAGCAGTTTGGCGTTCTGTGATTCCAGCATCAATCAT
     TTTTTTTGTGACACCACAGCTCTTTTAGCACTCTCCTGTGTAGATACATTCGGCACAGAAATGGTGAGCTTTGTC
     TTAGCTGGATTCACTCTTCTTAGCTCTCTCCTTATCATCACAGTCACTTATATCATCATCATCTCAGCCATCCTG
     AGGATCCAGTCAGCAGCAGGCAGGCAGAAGGCCTTCTCCACCTGCGCATCCCACCTCATGGCTGTAACTATCTTT
     TATGGGTCTCTGATTTTCACCTATTTGCAACCTGATAACACATCATCGCTGACCCAGGCGCAGGTGGCATCTGTA
     TTCTATACGATTGTCATTCCCATGCTGAATCCACTCATCTACAGTCTGAGGAACAAAGATGTGAAAAATGCTCTT
     CTGAGAGTCATACATAGAAAACTTTTTCCATGA
Generated by script: Mon Feb 5 11:00:34 2001
Comments to: MDR Croning