Human Genome: HGPCR0644

(C) Copyright 2001 M.D.R. Croning

HGPCR0644

(Q9UGF6)

BA150A6.2 (OLFACTORY RECEPTOR LIKE) PROTEIN (HS6M1-21)

Confirmed by human inspection

GPCR PRINTS Classification

Gene is located on clone: AL096770

Membrane topology: predictions

Signal peptide: prediction

GPCR Fingerprint, profile HMM, and generalised profile matches

SWALL FASTA: search                        Multiple sequence alignment

EMBL PATENT FASTA: search           Multiple sequence alignment

Predicted amino acid sequence (241 residues)

     MASKKQMNTRDSSRNRILQHKFTHPQENAGSECLLLAAMAYDRYIAICNPLRYSVILSKVLCNQLAASCWAAGFL
NSVVHTVLTFCLPFCGNNQINYFFCDIPPLLILSCGNTSVNELALLSTGVFIGWTPFLCIVLSYICIISTILRIQ
SSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEAVKTI
GSKWQPPISSLDSKLT

Predicted cDNA sequence (729 base pairs)

     ATGGCTTCAAAGAAGCAAATGAATACCAGAGATTCTTCTAGAAATCGCATTCTACAGCACAAGTTCACACATCCC
     CAAGAAAATGCCGGATCAGAGTGTCTCCTACTGGCAGCAATGGCATATGATCGTTACATTGCAATCTGCAATCCT
     TTAAGGTATTCAGTTATTCTGAGCAAGGTTCTATGCAATCAATTAGCAGCCTCATGCTGGGCTGCTGGTTTCCTT
     AACTCAGTGGTGCATACAGTGTTGACATTCTGCCTGCCCTTCTGTGGCAACAATCAGATTAATTACTTCTTCTGT
     GACATCCCCCCTTTGCTGATCTTGTCTTGTGGAAACACTTCTGTCAATGAGTTGGCACTGCTATCCACTGGGGTC
     TTCATTGGTTGGACTCCTTTCCTTTGTATCGTACTTTCCTACATTTGCATAATCTCCACCATCTTGAGGATCCAG
     TCCTCAGAGGGAAGACGAAAAGCCTTTTCTACATGTGCCTCCCACCTGGCCATTGTCTTTCTCTTTTATGGCAGC
     GCCATCTTTACATATGTACGGCCCATCTCAACTTACTCATTAAAGAAAGATAGGTTGGTTTCAGTGTTGTACAGT
     GTTGTTACCCCCATGCTAAACCCTATAATTTACACATTGAGGAATAAGGACATCAAAGAAGCTGTCAAAACTATA
     GGGAGCAAGTGGCAGCCACCAATTTCCTCTTTGGATAGTAAACTCACTTATTGA
Generated by script: Mon Feb 5 11:04:56 2001
Comments to: MDR Croning