Human Genome: HGPCR0789

(C) Copyright 2001 M.D.R. Croning

HGPCR0789

(O76000)

DJ80I19.1 (OLFACTORY RECEPTOR-LIKE PROTEIN (HS6M1-1)

Confirmed by computer

GPCR PRINTS Classification

Gene is located on clone: AL022727

Membrane topology: predictions

Signal peptide: prediction

GPCR Fingerprint, profile HMM, and generalised profile matches

SWALL FASTA: search                        Multiple sequence alignment

EMBL PATENT FASTA: search           Multiple sequence alignment

Predicted amino acid sequence (312 residues)

     MNWENESSPKEFILLGFSDRAWLQMPLFVVLLISYTITIFGNVSIMMVCILDPKLHTPMYFFLTNLSILDLCYTT
TTVPHMLVNIGCNKKTISYAGCVAHLIIFLALGATECLLLAVMSFDRYVAVCRPLHYVVIMNYWFCLRMAAFSWL
IGFGNSVLQSSLTLNMPRCGHQEVDHFFCEVPALLKLSCADTKPIEAELFFFSVLILLIPVTLILISYGFIAQAV
LKIRSAEGRQKAFGTCGSHMIVVSLFYGTAIYMYLQPPSSTSKDWGKMVSLFYGIITSMLNSLIYSLRNKDMKEA
FKRLMPRIFFCK

Predicted cDNA sequence (942 base pairs)

     ATGAATTGGGAAAATGAGAGCTCCCCAAAAGAGTTTATACTACTTGGCTTCTCAGATAGGGCTTGGCTACAAATG
     CCCCTTTTTGTGGTCCTGTTAATATCATACACAATCACCATATTTGGCAATGTGTCCATCATGATGGTGTGCATT
     CTGGATCCCAAACTTCATACTCCCATGTATTTCTTTCTCACTAATCTCTCCATCTTAGATCTCTGCTATACCACA
     ACTACAGTCCCTCATATGTTGGTAAATATTGGTTGCAACAAAAAGACCATCAGCTATGCTGGCTGTGTGGCCCAC
     CTCATCATCTTCCTGGCCCTAGGTGCTACAGAGTGTCTCCTTCTGGCTGTTATGTCCTTTGACAGATATGTGGCT
     GTTTGCAGACCCCTCCACTATGTAGTCATCATGAATTATTGGTTCTGCCTAAGGATGGCAGCCTTCTCATGGCTC
     ATTGGTTTCGGCAACTCAGTGCTGCAGTCTTCCTTGACTCTTAACATGCCACGCTGTGGTCACCAGGAAGTGGAC
     CACTTTTTCTGTGAGGTGCCTGCACTTCTCAAGTTGTCATGTGCTGACACAAAGCCTATTGAGGCTGAGCTCTTC
     TTCTTTAGTGTACTAATTCTTCTAATTCCAGTGACATTGATCCTCATCTCCTATGGCTTCATAGCTCAAGCAGTA
     TTAAAAATCAGGTCAGCAGAAGGACGGCAAAAAGCATTTGGGACATGTGGGTCCCACATGATTGTGGTGTCCCTC
     TTTTATGGAACAGCCATTTATATGTATCTTCAACCACCTTCATCCACCTCTAAGGACTGGGGAAAGATGGTTTCC
     CTCTTCTATGGAATCATCACATCCATGTTGAACTCCCTCATCTACAGCCTTAGAAATAAAGATATGAAGGAGGCC
     TTCAAGAGGCTGATGCCAAGAATCTTTTTCTGTAAGAAATAA
Generated by script: Mon Feb 5 11:07:55 2001
Comments to: MDR Croning