Human Genome: HGPCR0871

(C) Copyright 2001 M.D.R. Croning

HGPCR0871

PUTATIVE NOVEL OLFACTORY RECEPTOR

As assessed by human inspection

GPCR PRINTS Classification

Gene is located on clone: AL356607

Membrane topology: predictions

Signal peptide: prediction

GPCR profile HMM matches

SWALL FASTA: search                        Multiple sequence alignment

EMBL PATENT FASTA: search           Multiple sequence alignment

Predicted amino acid sequence (140 residues)

     MVYDFLYGNKSISFTGCGIQSFFFLTLAVAEGLLLTSMAYDRYVAICFPLHYPIRISKRYMHSVSHIASPEPSII
FSVRDPLRGTWEHASLALGRGGNGVTGKTLGGPNLIMMGAIPMWTPEDKARKTCGPPNQPEISRN

Predicted cDNA sequence (426 base pairs)

     ATGGTTTATGATTTTCTGTATGGAAACAAGTCTATCTCCTTCACTGGATGTGGGATTCAGAGTTTCTTCTTCTTG
     ACTTTAGCAGTTGCAGAAGGGCTGCTCCTGACATCAATGGCCTATGATCGTTATGTGGCCATTTGCTTTCCTCTC
     CACTATCCCATCCGTATAAGCAAAAGATATATGCACTCTGTATCCCATATTGCAAGTCCAGAGCCATCAATCATT
     TTTTCTGTGAGGGATCCTCTGAGAGGTACCTGGGAGCATGCAAGCTTGGCGCTGGGCCGCGGTGGAAACGGCGTG
     ACTGGTAAAACCCTGGGCGGGCCCAACTTAATAATGATGGGAGCCATCCCCATGTGGACACCCGAAGACAAGGCA
     CGAAAGACCTGCGGGCCGCCCAACCAACCGGAAATCTCTCGTAACGAGTAA
Generated by script: Mon Feb 5 11:09:48 2001
Comments to: MDR Croning