Human Genome: HGPCR1015

(C) Copyright 2001 M.D.R. Croning

HGPCR1015

PUTATIVE NOVEL OLFACTORY RECEPTOR

As assessed by human inspection

GPCR PRINTS Classification

Gene is located on clone: AC016856

Membrane topology: predictions

Signal peptide: prediction

GPCR Fingerprint, profile HMM, and generalised profile matches

SWALL FASTA: search                        Multiple sequence alignment

EMBL PATENT FASTA: search           Multiple sequence alignment

Predicted amino acid sequence (398 residues)

     SESTGLRTQRLLWIEQESAWEDDSKSEKCSLARDFMPSHSDPSALKTNYAVDSWNLESTGTQSLEENEEEYGEHP
KLKPTVHIVSMAKNNLTRVTEFILMGFMDHPKLEIPLFLVFLSFYLVTLLGNVGMIMLIQVDVKLYTPMYFFLSH
LSLLDACYTSVITPQILATLATGKTVISYGHCAAQFFLFTICAGTECFLLAVMAYDRYAAIRNPLLYTVAMNPRL
CWSLVVGAYVCGVSGAILRTTCTFTLSFCKDNQINFFFCDLPPLLKLACSDTANIEIVIIFFGNFVILANASVIL
ISYLLIIKTILKVKSSGGRAKTFSTCASHITAVALFFGALIFMYLQSGSGKSLEEDKVVSVFYTVVIPMLNPLIY
SLRNKDVKDAFRKVARRLQVSLS

Predicted cDNA sequence (1202 base pairs)

     GCAGCGAAAGCACTGGGCTAAGAACCCAAAGGCTACTGTGGATTGAACAAGAAAGTGCATGGGAAGATGATTCTA
     AAAGTGAAAAGTGTTCACTTGCAAGGGATTTCATGCCTTCTCACTCTGACCCATCTGCTCTCAAGACTAACTATG
     CAGTAGACTCTTGGAACTTAGAGTCCACAGGGACTCAATCTTTGGAGGAAAATGAAGAAGAGTATGGAGAACATC
     CCAAGTTAAAACCAACAGTCCACATTGTCTCCATGGCCAAGAATAATCTCACCAGAGTAACCGAATTCATTCTCA
     TGGGCTTTATGGACCACCCCAAATTGGAGATTCCCCTCTTTCTGGTGTTTCTGAGTTTCTACCTAGTCACCCTTC
     TTGGGAATGTGGGGATGATTATGTTAATCCAAGTAGATGTCAAACTCTACACCCCAATGTACTTCTTCCTGAGCC
     ACCTCTCCCTGCTGGATGCCTGTTACACCTCAGTCATCACCCCTCAGATCCTAGCCACATTGGCCACAGGCAAAA
     CGGTCATCTCCTACGGCCACTGTGCTGCCCAGTTCTTTTTATTCACCATCTGTGCAGGCACAGAGTGCTTTCTGC
     TGGCAGTGATGGCCTATGATCGCTATGCTGCCATTCGCAACCCACTGCTCTATACCGTGGCCATGAATCCCAGGC
     TCTGCTGGAGCCTGGTGGTAGGAGCCTATGTCTGTGGGGTGTCAGGAGCCATCCTGCGTACCACTTGCACCTTCA
     CCCTCTCCTTCTGTAAGGACAATCAAATAAACTTCTTCTTCTGTGACCTCCCACCCCTGCTGAAGCTTGCCTGCA
     GTGACACAGCAAACATCGAGATTGTCATCATCTTCTTTGGCAATTTTGTGATTTTGGCCAATGCCTCCGTCATCC
     TGATTTCCTATCTGCTCATCATCAAGACCATTTTGAAAGTGAAGTCTTCAGGTGGCAGGGCCAAGACTTTCTCCA
     CATGTGCCTCTCACATCACTGCTGTGGCCCTTTTCTTTGGAGCCCTTATCTTCATGTATCTGCAAAGTGGCTCAG
     GCAAATCTCTGGAGGAAGACAAAGTCGTGTCTGTCTTCTATACAGTGGTCATCCCCATGCTGAACCCTCTGATCT
     ACAGCTTAAGAAACAAAGATGTAAAAGACGCCTTCAGAAAGGTCGCTAGGAGACTCCAGGTGTCCCTGAGCATGT
     AG
Generated by script: Mon Feb 5 11:13:41 2001
Comments to: MDR Croning