Human Genome: HGPCR1049

(C) Copyright 2001 M.D.R. Croning

HGPCR1049

(O95006)

WUGSC:H_DJ0669B10.1 PROTEIN

Confirmed by computer

GPCR PRINTS Classification

Gene is located on clone: AC004853

Membrane topology: predictions

Signal peptide: prediction

GPCR Fingerprint, profile HMM, and generalised profile matches

SWALL FASTA: search                        Multiple sequence alignment

EMBL PATENT FASTA: search           Multiple sequence alignment

Predicted amino acid sequence (280 residues)

     MTVLGNCLIVLLIRLDSRLHTPMYFFLTNLSLVDVSYATSVVPQLLAHFLAEHKAIPFQSCAAQLFFSLALGGIE
FVLLAVMAYDRHVAVSDRLRYSAIMHGGLCARLAITSWVSGSINSLVQTAITFQLPMCTNKFIDHISCELLAVVR
LACVDTSSNEAAIMVSSIVLLMTPFCLVLLSYIRIISTILKIQSREGRKKAFHTCASHLTVVALCYGTTIFTYIQ
PHSGPSVLQEKLISVFYAIVMPLLNPVIYSLRNKEVKGAWHKLLEKFSGLTSKLG

Predicted cDNA sequence (846 base pairs)

     ATGACAGTGCTGGGGAACTGTCTCATTGTCCTTCTGATCAGACTGGACAGCCGACTCCACACTCCCATGTATTTC
     TTTCTCACCAACCTCTCCCTTGTCGATGTCTCCTATGCCACAAGCGTAGTCCCCCAGCTGCTGGCACATTTTCTT
     GCAGAACATAAAGCCATCCCATTCCAGAGCTGTGCAGCCCAGTTATTTTTCTCCCTGGCCTTGGGTGGGATTGAG
     TTTGTTCTCCTGGCAGTGATGGCCTATGACCGCCATGTGGCTGTGTCTGACCGCCTGCGATACTCGGCCATCATG
     CATGGAGGGCTGTGTGCTAGGTTGGCCATCACATCCTGGGTCAGTGGCTCCATCAACTCTCTTGTGCAGACTGCT
     ATCACCTTTCAGCTGCCCATGTGCACTAACAAGTTTATTGATCACATATCCTGTGAACTCCTAGCTGTGGTCAGG
     CTGGCTTGTGTGGACACCTCCTCCAATGAGGCTGCCATCATGGTGTCTAGCATTGTTCTTCTGATGACACCTTTC
     TGCCTGGTTCTGTTGTCCTACATCCGGATCATCTCCACCATCCTAAAGATCCAGTCCAGAGAAGGAAGAAAGAAA
     GCCTTCCACACGTGTGCCTCTCACCTCACGGTGGTTGCCCTGTGCTACGGCACAACGATTTTCACTTACATCCAG
     CCCCACTCTGGTCCCTCAGTCCTTCAAGAGAAGCTGATCTCTGTCTTCTATGCCATTGTTATGCCTCTGCTGAAC
     CCTGTGATTTATAGTCTAAGGAATAAAGAGGTGAAGGGGGCCTGGCATAAACTATTAGAGAAATTCTCTGGGTTA
     ACATCCAAGCTGGGAACTTGA
Generated by script: Mon Feb 5 11:14:55 2001
Comments to: MDR Croning