Human Genome: HGPCR1087

(C) Copyright 2001 M.D.R. Croning

HGPCR1087

PUTATIVE NOVEL OLFACTORY RECEPTOR

As assessed by human inspection

GPCR PRINTS Classification

Gene is located on clone: AC026975

Membrane topology: predictions

Signal peptide: prediction

GPCR Fingerprint, profile HMM, and generalised profile matches

SWALL FASTA: search                        Multiple sequence alignment

EMBL PATENT FASTA: search           Multiple sequence alignment

Predicted amino acid sequence (302 residues)

     MTEFIFLVLSPNQEVQRVCFVIFLFLYTAIVLGNFLIVLTVMTSRSLGSPMYFFLSYLSFMEICYSSATAPKLIS
DLLAERKVISWWGCMAQLFFLHFFGGTEIFLLTVMAYDHYVAICKPLSYTTIMNWQVCTVLVGIAWVGGFMHSFA
QILLIFHLLFCGPNVINHYFCDLVPLLKLACSDTFLIGLLIVANGGTLSVISFGVLLASYMVILLHLRTWSSEGW
CKALSTCGSHFAVVILFFGPCVFNSLRPSTTLPIDKMVAVFYTVITAILNPVIYSLRNAEMRKAMKRLWIRTLRL
NE

Predicted cDNA sequence (912 base pairs)

     ATGACTGAATTCATTTTTCTGGTACTTTCTCCCAACCAGGAGGTGCAGAGGGTTTGCTTTGTGATATTTCTGTTC
     TTGTACACAGCAATTGTGCTGGGGAATTTCCTCATTGTGCTCACTGTCATGACCAGCAGAAGCCTTGGTTCCCCC
     ATGTACTTCTTCCTCAGCTACCTCTCCTTCATGGAGATCTGCTACTCCTCCGCTACAGCCCCCAAACTCATCTCA
     GATCTGCTGGCTGAAAGGAAAGTCATATCTTGGTGGGGCTGCATGGCACAGCTTTTCTTCTTGCACTTCTTTGGT
     GGCACTGAGATTTTCCTGCTCACTGTGATGGCCTATGACCACTATGTGGCCATCTGCAAGCCCCTCAGCTACACC
     ACCATCATGAACTGGCAGGTGTGTACTGTCCTTGTAGGAATAGCATGGGTGGGAGGCTTCATGCATTCCTTTGCA
     CAAATCCTTCTCATCTTCCACCTGCTCTTCTGTGGCCCCAATGTGATCAATCACTATTTCTGTGACCTAGTTCCC
     CTTCTCAAACTTGCCTGCTCTGACACCTTCCTCATTGGTCTGCTGATTGTTGCCAATGGAGGCACCCTGTCTGTG
     ATCAGTTTTGGGGTCCTCTTAGCATCCTATATGGTCATCTTGCTCCATCTGAGAACCTGGAGCTCTGAAGGGTGG
     TGCAAAGCCCTCTCCACCTGTGGGTCCCATTTCGCTGTGGTTATCTTGTTCTTTGGGCCCTGCGTCTTCAACTCT
     CTGAGGCCTTCTACCACTCTGCCCATAGACAAGATGGTGGCTGTGTTCTACACAGTGATAACCGCGATCCTGAAC
     CCTGTCATCTACTCTCTGAGAAATGCTGAAATGAGGAAGGCCATGAAGAGGCTGTGGATTAGGACATTGAGACTA
     AATGAGAAATAG
Generated by script: Mon Feb 5 11:15:52 2001
Comments to: MDR Croning