SenseLab
Chemosensory Receptors
  Data
ORL995
6
OR5U1
ATGGTCAATTTGACTTCAATGAGTGGATTCCTTCTTATGGGGTTTTCTGATGAGCGTAAGCTTCAGATTTTACATGCATTGGTATTTCTGGTGACATACCTGCTGGCCTTGACAGGCAACCTCCTCATTATCACCATCATTACCGTGGACCGTCGTCTCCATTCCCCCATGTATTACTTTTTAAAGCACCTCTCTCTTCTGGACCTCTGCTTCATCTCTGTCACAGTCCCCCAGTCCATTGCAAATTCACTTATGGGCAACGGTTACATTTCTCTTGTTCAGTGCATTCTTCAGGTTTTCTTCTTCATAGCTCTGGCCTCATCAGAAGTGGCCATTCTCACAGTGATGTCTTATGACAGGTACGCAGCAATCTGTCAACCACTTCATTATGAGACTATTATGGATCCCCGTGCCTGTAGGCATGCAGTGATAGCTGTGTGGATTGCTGGGGGCCTCTCTGGGCTCATGCATGCTGCCATTAACTTCTCCATACCTCTCTGTGGGAAGAGAGTCATTCACCAATTCTTCTGTGATGTTCCTCAGATGCTGAAACTAGCCTGTTCTTATGAATTCATTAATGAGATTGCACTGGCTGCATTCACAACGTCTGCAGCATTTATCTGTTTGATCTCCATTGTGCTCTCCTACATTCGCATCTTCTCTACAGTGCTGAGAATCCCATCAGCTGAGGGCCGGACCAAGGTCTTCTCCACCTGCCTACCACACCTATTTGTAGCCACCTTCTTTCTTTCAGCTGCAGGCTTTGAGTTTCTCAGACTGCCTTCTGATTCCTCATCGACTGTGGACCTTGTATTCTCCGTATTCTATACTGTGATACCTCCAACACTCAATCCAGTCATTTATAGCTTACGGAATGATTCCATGAAGGCAGCACTGAGGAAGATGCTGTCAAAGGAAGAGCTTCCTCAGAGAAAAATGTGCTTAAAAGCCATGTTTAAACTCTGA
MVNLTSMSGFLLMGFSDERKLQILHALVFLVTYLLALTGNLLIITIITVDRRLHSPMYYFLKHLSLLDLCFISVTVPQSIANSLMGNGYISLVQCILQVFFFIALASSEVAILTVMSYDRYAAICQPLHYETIMDPRACRHAVIAVWIAGGLSGLMHAAINFSIPLCGKRVIHQFFCDVPQMLKLACSYEFINEIALAAFTTSAAFICLISIVLSYIRIFSTVLRIPSAEGRTKVFSTCLPHLFVATFFLSAAGFEFLRLPSDSSSTVDLVFSVFYTVIPPTLNPVIYSLRNDSMKAALRKMLSKEELPQRKMCLKAMFKL
Other categories referring to ORL995
OR Model.Chemosensory receptor   (1)
Revisions: 4
Last Time: 8/21/2013 4:27:11 PM
Reviewer: Chiquito
Owner: Chiquito