SenseLab
Chemosensory Receptors
  Data
ORL9364
PREDICTED: Gallus gallus similar to olfactory receptor Olr390 (LOC431295), mRNA
atggccggggggaaccagactcaggtgacagagatccagctgctgagcttttcccaaggccagcccttcctcttcctccttttcctggccacctacctggtcacgctgctggggaactccgcaatactcactctggtgctcctggacacccatctccacaaccccatgtatttcttcctcagccacctctcctgtttggatatctgctactcaacggtgaccgtgcccaaggtcttggccaacagcctccttccgcgggcggccatctcctacggtggctgcctggcgcagaccttcttcctgatgagctgcgcgggggctgagtgcgcactgctggccgtcatggcctacgaccgctacgccgccatcgtgcaccccctgcactacgcacacgccatgcgcggggctgcatgctgggccatggtcacgggctgctggctgtggggagcgctggactcggcggtgcacaccctgctggcctcccatctgtccttctgcggcgccgtccgcctgcggcacctcttctgcgacgtccccccgctgctgagggctgcctgtggcaacacgtggcccagccaggcggccctgcacgcggccagcgtcttcatgggcttcggccccttcctgctggttctcggctcctacctacgcatcttggtggctgtgctggccgtgcccacggccgctggccgccacaaggccttctccacctgctctgcccacctgctggtggtcacgctctactttgtgacggccaacctcaactacaaccagctcaatgccgactacccgctgctggccgacgctgtggtgtcggtgctgttctgcatcgtcacccccgcgctgaaccccctcatctacagcctccgcaatcaggaggtgcggggggccctgaggagggtcctgtgtgggcggtggggctaccggggccgtgggattgatgtagaggcccccagagtgcaagggaaaatagtgggaccatag
MAGGNQTQVTEIQLLSFSQGQPFLFLLFLATYLVTLLGNSAILTLVLLDTHLHNPMYFFLSHLSCLDICYSTVTVPKVLANSLLPRAAISYGGCLAQTFFLMSCAGAECALLAVMAYDRYAAIVHPLHYAHAMRGAACWAMVTGCWLWGALDSAVHTLLASHLSFCGAVRLRHLFCDVPPLLRAACGNTWPSQAALHAASVFMGFGPFLLVLGSYLRILVAVLAVPTAAGRHKAFSTCSAHLLVVTLYFVTANLNYNQLNADYPLLADAVVSVLFCIVTPALNPLIYSLRNQEVRGALRRVLCGRWGYRGRGIDVEAPRVQGKIVGP
Other categories referring to ORL9364
Revisions: 1
Last Time: 3/21/2008 11:18:37 AM
Reviewer: CC student
Owner: CC student