SenseLab
Chemosensory Receptors
  Data
ORL9378
PREDICTED: Gallus gallus similar to olfactory receptor MOR180-1 (LOC430735), mRNA
atgctggagggaaatctcaccacggtgacagagtttgttctccaaggcttcactgacagccctcagatacaagccttcctcttcactctgctgctcctcatttacaccgccaccctggtggggaatatcaccatcatcacattaacccgagttgactctcacctgcagacccccatgtactttttcctctgtaacctgtccttcattgacatcacctactcctctgcaatcgctcccaagacgctggcgaatctgttagcagagaagaaggtaatttcatttcctggctgtgctgcgcaattttttcttcactctttttccatcaatgctgaagtcgtgctcttagctgtgatggcatacgatcggtttgtatctgtttgcaacccattgcggtatgcagtccttatgtccagacaggagtgtgctctgttggtctctgtctcatacctgtgtggatgcatcagttcagttgcccacacagcttccctgttcagcctgtccttctgcaggtcccgtgtcatcgatcactttttctgcgacatccccccactgcagcagctctcctgctctgacacacgctttgcacacggggtacacgtggcctttgctgcagcgacaggctcaggcactgtcagcatcatcctcatctcttacctgttcattatctttgctgtcctgcagattcgtgctgcccaagtcaggtggaaagccttttccacctgtgcctcccacctgtctgctgtcaccctgttttatggaactctcttcttcatctacttaagacctgtgcccagcagctctgctgatcagtgcaaagtggtggctgtgttttacacactggtaatccctgcggtgaaccccctgatttacagcctgaggaacagggaggtgaaggatgctctgaggagggtgatactgaaagcatttgtcagtaagtaa
MLEGNLTTVTEFVLQGFTDSPQIQAFLFTLLLLIYTATLVGNITIITLTRVDSHLQTPMYFFLCNLSFIDITYSSAIAPKTLANLLAEKKVISFPGCAAQFFLHSFSINAEVVLLAVMAYDRFVSVCNPLRYAVLMSRQECALLVSVSYLCGCISSVAHTASLFSLSFCRSRVIDHFFCDIPPLQQLSCSDTRFAHGVHVAFAAATGSGTVSIILISYLFIIFAVLQIRAAQVRWKAFSTCASHLSAVTLFYGTLFFIYLRPVPSSSADQCKVVAVFYTLVIPAVNPLIYSLRNREVKDALRRVILKAFVSK
Other categories referring to ORL9378
Revisions: 1
Last Time: 3/21/2008 11:47:20 AM
Reviewer: CC student
Owner: CC student