SenseLab
Chemosensory Receptors
  Data
ORL9410
PREDICTED: Gallus gallus similar to olfactory receptor MOR41-1 (LOC428119), mRNA
atggctcctggccccttcagccgccccaacagcagctcctcctccttcatccttgtgggcatccccaacctggaagctttccccatctgcctgggcatccttttctgctcagcgtacatcctcaccttgctaggaaatagcatggttctgctcgtcatcgtgctggacaagtccctgcgggaccccatgcactgcttcctggccatgctggccgccatcgacgcggtgatggtgacgtccatcgtccccaagctgctgggcatcttctggctccattccaaccagatcggttacaccgcctgttttgttcagatgttctttgttcactccacaacatcagaggagtcgggagtgctcttggccatggctttcgaccgctacgttgccatttgtcaccccctcaggtacaggatgatcctgaaccgacgaacagttgcccggatatgcctggccatcgtggtgagagcgctactttgcatgctcccactgacagggatggtgacaaacctcccctactgccgttccctcgtggtcccccattcatactgcgagcacatggctgtcaccagtcttgcctgcgcagaccccaaccccagcagactgtacagcatgtcgatgtcctctctcatagtagggatggacacagctttcattgctgtgtcctacctgatgatcctgaaagccgtcctgggcaaggaatcgtgcaggagggccttcagcacctgcgggtgccacatctgtgtgatgatgctgtactacatccccggcctggtctccatctacgtgcagcagttcagccacgctgtgtctgtgcgtgcacaggttctgctggccgacctctacctcaccctccccacgatgctgaaccccatcatctacagcatgaggaccaggcggatccggaaggcaatgctcaacgtgctgattcccaggaaggctcacgcctgtcacagcactcagtga
MAPGPFSRPNSSSSSFILVGIPNLEAFPICLGILFCSAYILTLLGNSMVLLVIVLDKSLRDPMHCFLAMLAAIDAVMVTSIVPKLLGIFWLHSNQIGYTACFVQMFFVHSTTSEESGVLLAMAFDRYVAICHPLRYRMILNRRTVARICLAIVVRALLCMLPLTGMVTNLPYCRSLVVPHSYCEHMAVTSLACADPNPSRLYSMSMSSLIVGMDTAFIAVSYLMILKAVLGKESCRRAFSTCGCHICVMMLYYIPGLVSIYVQQFSHAVSVRAQVLLADLYLTLPTMLNPIIYSMRTRRIRKAMLNVLIPRKAHACHSTQ
Other categories referring to ORL9410
Revisions: 1
Last Time: 3/21/2008 12:44:50 PM
Reviewer: CC student
Owner: CC student