SenseLab
Chemosensory Receptors
  Data
ORL9427
PREDICTED: Gallus gallus similar to olfactory receptor MOR260-5 (LOC417291), mRNA
atgcatggtcctgcaggactagaactggcaggcattccacttgttccaaacattgtcctcagtgtgaaccccgagcccctgcagaggggaaatctcagcagccccacctcatttcttctcttggggttttccactgcctacaaagcacaggtacccctctgcatgggcttctctctcatttacctggtgactgtgctggggaacctgctcgtaatgaccctggtctggctggatgcttacctgcagtcccccatgtactacttcctgggccacctctccttcctggacatctgctactcctccgtcacactccctaagatcctcagagactccttctcaccacagaagactatttccttggggggctgcatcacgcagatctacttcttcctttgctttgggggctctgagtgtgtgctgctggctgccatggcctacgatcggtacgtggccatctgccaccccctccactacacagcactcatgagcaagaagatctgccgctgcctagtggctgcctcatggttgagtggctccttctcatctctgatccaggccctcctcacagcccacttacacttctgtgagtccaatgtaatcaaccatttgttctgtgagatccccttcttgctggaagtgtcctgcagccctaacactcttctcaacaaggctgtctcatatgctttgactgtgactattgccgtgggctctttcctcattactctctcatcatatgttcgcatcctccaggctgtgctgcagaagggagcagggaggcagaaggcctttgccacctgcacctcccacctgatcgtggtgtccctgttctttggcactggggctgttacatacctgatccctcgatccagcagctccaaggagatgaacaagatcctcgccctgctgtacgccattgtaacccccatgctgaaccccatcatctatagtttaagaaacaatgagttccagggggccatcaggaaagccctgtgcaggggtatcactgagctcccccaaggacacagcaggtga
MHGPAGLELAGIPLVPNIVLSVNPEPLQRGNLSSPTSFLLLGFSTAYKAQVPLCMGFSLIYLVTVLGNLLVMTLVWLDAYLQSPMYYFLGHLSFLDICYSSVTLPKILRDSFSPQKTISLGGCITQIYFFLCFGGSECVLLAAMAYDRYVAICHPLHYTALMSKKICRCLVAASWLSGSFSSLIQALLTAHLHFCESNVINHLFCEIPFLLEVSCSPNTLLNKAVSYALTVTIAVGSFLITLSSYVRILQAVLQKGAGRQKAFATCTSHLIVVSLFFGTGAVTYLIPRSSSSKEMNKILALLYAIVTPMLNPIIYSLRNNEFQGAIRKALCRGITELPQGHSR
Other categories referring to ORL9427
Revisions: 1
Last Time: 3/21/2008 3:07:21 PM
Reviewer: CC student
Owner: CC student