SenseLab
Chemosensory Receptors
  Data
ORL9428
PREDICTED: Gallus gallus similar to seven transmembrane helix receptor (LOC427519), mRNA
atgagaattcttgaggaaatgaagcctggaaaccaaaccactgttactcacttcttaatttgggggtttggcctacatggcaagatgaagctcctgttttccatagtgatttctgtcatgttcctggccaccatgataggtaactctctaattgtggggatcacagccattgactctgccctacatactcccatgtactatttcctaaagaatcttgccttgacagagatctgctacagcttgagcattgtccccaagatgctcttgattctgctgggggagagaaaaattatttccttcacagcttgtgccttgcaactcagttgtgctatactttttgtcacctgtgagtgctttctcttaggtgtaatggcctatgaccgacaagtggcaatatgccaccctctgcattatggcaccatgatgaacagggacctctgcttcaaaatggctgttgggtcttggctctctgggatacctgttgctctggtcttccccatatggctgtttaccctgcccttctgtgggagaaacaaggtagatcatttcttttgtgatgtttctcccgtgttgaacctggtgtgtgcagacacagctttgtttgaactactgatttttatggctacagtcatgatagtgatgatccccttttcactgatcattatttcctaccttctcattattcatgctgttcttcagataccctcggctgtgggtcagaggcaggccttttccacatgtgcagctcacctggtagtagtaacttttttctacagcacaacaggcatcattcacttgcgtcctaagtccagcctctcaagcaatatgaagaaaatggtttccctctcttacacagttgttacgcctatgatcaaccccttcatctatagcttgaggaatcagaaagtcaagcaaagtctgagggaatgcatcaacaagaggctacttaggaagcagatgatcttttctctgtccagctcatga
MRILEEMKPGNQTTVTHFLIWGFGLHGKMKLLFSIVISVMFLATMIGNSLIVGITAIDSALHTPMYYFLKNLALTEICYSLSIVPKMLLILLGERKIISFTACALQLSCAILFVTCECFLLGVMAYDRQVAICHPLHYGTMMNRDLCFKMAVGSWLSGIPVALVFPIWLFTLPFCGRNKVDHFFCDVSPVLNLVCADTALFELLIFMATVMIVMIPFSLIIISYLLIIHAVLQIPSAVGQRQAFSTCAAHLVVVTFFYSTTGIIHLRPKSSLSSNMKKMVSLSYTVVTPMINPFIYSLRNQKVKQSLRECINKRLLRKQMIFSLSSS
Other categories referring to ORL9428
Revisions: 1
Last Time: 3/21/2008 3:09:20 PM
Reviewer: CC student
Owner: CC student