SenseLab
Chemosensory Receptors
  Data
ORL9429
PREDICTED: Gallus gallus similar to chick olfactory receptor 7 (LOC415592), mRNA
atggagaagaattccacccaaatcaacatctttctcttgcaaggattcccaggccttatggacttgaaggtattgctcttcatagtattgctgctgacatacattgtaacggttgtggagaatgtgctcatcatttccctgatcaaagcaaaccatgaactctgcaaacccatgtatttctttcttggtcagctgtctttcattgaggtctggtacatctctgtcattgtccccaaactcttggcaaatttcattgcagaagacaggagcatttcctttgctggatgcatgacccaactctatttcttcagttctttcttatgcactgaatgtgtccttctctctgccatggcgtacgatcgctatgtggccatctgtcaaccactgcgctatctcttcatcatgacgtaccaaatgtgcatatgcctgatagctctctcctggttcactgggttcactgtgtccttgatcaagatttccttcatctctcagttggagttctgtggttcccatgttattaaccatttcttctgtgacgtcagcccagtgctaaaccttgcctgcactgatatgtcagtggcagaaatggtggactttgtgttggccttgttcatcctgctcgttcccctctccatcacggttgtctcctacctattaattatcacaacaatcctgcgcatccccaccacccaaagtaagaagaaagccttctctacatgtgcttcccacttaactgtggttgtcattttcttctcagccactctcttcatgtacgcgcggcccaagaaaatctcttcttatgatatgaataaacttgtgtcagctgtgtatacaattgtcacacccatgttaaaccctttcgtgtactgcctgaggaatcagggactgaagagagcatttaaaaaagctctctcagtaaaaatcactctctctgaagtctccagaaccattccttctctccaaatcacaacaggcatcattcacttgcgtcctaagtccagcctctcaagcaatatgaagaaaatggtttccctctcttacacagttgttacgcctatgatcaaccccttcatctatagcttgaggaatcagaaagtcaagcaaagtctgagggaatgcatcaacaagaggctacttaggaagcagatgatcttttctctgtacagctcatga
MEKNSTQINIFLLQGFPGLMDLKVLLFIVLLLTYIVTVVENVLIISLIKANHELCKPMYFFLGQLSFIEVWYISVIVPKLLANFIAEDRSISFAGCMTQLYFFSSFLCTECVLLSAMAYDRYVAICQPLRYLFIMTYQMCICLIALSWFTGFTVSLIKISFISQLEFCGSHVINHFFCDVSPVLNLACTDMSVAEMVDFVLALFILLVPLSITVVSYLLIITTILRIPTTQSKKKAFSTCASHLTVVVIFFSATLFMYARPKKISSYDMNKLVSAVYTIVTPMLNPFVYCLRNQGLKRAFKKALSVKITLSEVSRTIPSLQITTGIIHLRPKSSLSSNMKKMVSLSYTVVTPMINPFIYSLRNQKVKQSLRECINKRLLRKQMIFSLYSS
Other categories referring to ORL9429
Revisions: 1
Last Time: 3/21/2008 3:10:54 PM
Reviewer: CC student
Owner: CC student