SenseLab
Chemosensory Receptors
  Data
ORL9430
PREDICTED: Gallus gallus similar to bM332P19.2 (novel 7 transmembrane receptor (rhodopsin family) (olfactory receptor like) protein (mm17M1-13); ortholog of human DJ994E9.8 (HS6M1-20)) (LOC427485), mRNA
atggaacatatctgcctggaagctatgcaaagacgcatgcaagacaaagaggtgatccgtgtcagccagcagaacagcatgggggacattgtgcctgccaaactgggggctttctatggagtgacagcactggtggacaaagggaggggaactgatgttgtctacctggacttctgcaaggccttttctagggtctcacatcacactcttgtctctaaattggagagatacaatcccagatgtgtgtacagactgggagaactcgtggagatcattcctgctgagaaggacttgagggttctggtgaacaaaaaggttgacatgaagcaacagtgtttgcttgcagcctggaaggccaactgtatcctgtgctgcaccaaaagagggatggatggaatgctgaaccatacggaggtgtgcgagttcatccttttgggcctcactgacatccaagggctacagtacttcttcttcatctccttcctgttactctacttgactagcattttgggaaatggtgtcattgtgaccatggtgatatctcagccccagctccacacaccgatgtacttcttcctggggaacctttcctgcctggacattttctactctacagttactgttcccaagatgctgactggttttctctttggacgtcaacccatttcttttggtgggtgcttggcccagctctacttcttccacttcctgggcagtactgaagctgtgctcctggccaccatggcctatgatcgctatgtggccatttgcaaccctctgtgctacacccttgtcatgaacccaaggacttgtctgctgctggccacggccagctggtctgttggttttgcacatgccatgatgcattcaatcatgacctctcaactgagtttctgtgggcacaaccacattcatcacttcttctgcgatgtcaagccactgttgaacttggcctgcagtagtactagcctcagcatgactctcctcaatgttgtcaccacatcaattgctctaggcccattcattctgattgtcctctcctatctctacatcatcatcttcctcttccagaaggtcaagtcccaggaaggtagatggaagcccttctccacctgtgcctctcatcttactgttgtggcactattgtacataccgctgttcttcaattatacacctccgtcttcatccagctcctctaacagggacatgcaagtgtctgtcatgtacagtgccatcaccccagctctaaaccccttgatctatactcttaggaatcaggaggtgagatctactttgaacaaaatcctccagaaaagaagtatgcgtgtctcttgcagagcatga
MEHICLEAMQRRMQDKEVIRVSQQNSMGDIVPAKLGAFYGVTALVDKGRGTDVVYLDFCKAFSRVSHHTLVSKLERYNPRCVYRLGELVEIIPAEKDLRVLVNKKVDMKQQCLLAAWKANCILCCTKRGMDGMLNHTEVCEFILLGLTDIQGLQYFFFISFLLLYLTSILGNGVIVTMVISQPQLHTPMYFFLGNLSCLDIFYSTVTVPKMLTGFLFGRQPISFGGCLAQLYFFHFLGSTEAVLLATMAYDRYVAICNPLCYTLVMNPRTCLLLATASWSVGFAHAMMHSIMTSQLSFCGHNHIHHFFCDVKPLLNLACSSTSLSMTLLNVVTTSIALGPFILIVLSYLYIIIFLFQKVKSQEGRWKPFSTCASHLTVVALLYIPLFFNYTPPSSSSSSNRDMQVSVMYSAITPALNPLIYTLRNQEVRSTLNKILQKRSMRVSCRA
Other categories referring to ORL9430
Revisions: 1
Last Time: 3/21/2008 3:13:07 PM
Reviewer: CC student
Owner: CC student