SenseLab
Chemosensory Receptors
  Data
ORL9431
Gallus gallus chick olfactory receptor 7 (cor7a), mRNA
atggaggagaagaattccacccaaatcaacatctttctcttgctaggattcccaggccttatggacttgaaggtattgctcttcatagtattgctgctgacatacattgtaacggttgtggagaatgtgctcatcatttccctgatcaaagcaaaccatgaactctgcaaacccatgtatttctttcttggtcagctgtctttcattgaggtctggtacatctctgtcactgtccccaaactcctggcaaatttcattgcagaagacaggagcatttcctttgctggatgcatgacccaactctatttcttcatttctttcatgtgcactgaatgtgtccttctctctgccatggcgtacgatcgctatgtggccatctgtcaaccactgcactatctcttcatcatgacgtaccaaatgtgcgtatgcctgatagctctctcctggttcactgggttcactgtgtccttgatcaagatttccttcatctctcagttggagttctgtggttcccatgttattaaccatttcttctgtgacatcagcccagtgctaaaccttgcctgcactgatatgtcagtggcagagatggtggactttgtgttggccttgttcatcctgctcgttcccctctccatcacggttgtctcctacctattaattatcacaacaatcctgcacatccccaccacccaaagtaagaagaaagccttctctacatgtgcttcccacttaactgtggtcgtcattttcttctcagccactctcttcatgtatgcgcggcccaagaaaatctcttcttatgatatgaataaacttgtgtcagctgtgtatacaattgtcacacccatgttaaaccccttcatttactgcctgaggaatcaggaactgaagagagcatttaaaaaagctctctcagtaaaaatcactgtctctgaagtctccagaaccattccttccatccaaatgtaa
MEEKNSTQINIFLLLGFPGLMDLKVLLFIVLLLTYIVTVVENVLIISLIKANHELCKPMYFFLGQLSFIEVWYISVTVPKLLANFIAEDRSISFAGCMTQLYFFISFMCTECVLLSAMAYDRYVAICQPLHYLFIMTYQMCVCLIALSWFTGFTVSLIKISFISQLEFCGSHVINHFFCDISPVLNLACTDMSVAEMVDFVLALFILLVPLSITVVSYLLIITTILHIPTTQSKKKAFSTCASHLTVVVIFFSATLFMYARPKKISSYDMNKLVSAVYTIVTPMLNPFIYCLRNQELKRAFKKALSVKITVSEVSRTIPSIQM
Other categories referring to ORL9431
Revisions: 1
Last Time: 3/21/2008 3:15:57 PM
Reviewer: CC student
Owner: CC student