SenseLab
Chemosensory Receptors
  Data
ORL9432
PREDICTED: Gallus gallus olfactory receptor, family 5, subfamily AS, member 1 (OR5AS1), mRNA
ccagattaaagtcacctttatgaaaacaagcaaacaaacaaacaaaccacctacatgcaatagcactagcttttggagtccagtcagttacaggtaagattatggagattcaagagtacatttcttgctgcagtatttggatagatttttacatgctccaccaggcgtgcaacaaaacaaaataacaactgcaaatccttgttgcagcccttctcacctcagcgtgaaggcacgatcaggctacaattccagaacaaacctaaaatggccagttccattttctctgtgtaacgaactccgtttccttcacactgatccctctttgtaattcagcagatctcccagtgcatcccgcaagcgtcagatggatgggaggaatgagagcaggatgacccaattcatcctcctaggactgacagatggcacggagctgcaggtccctctcttcttcatcttctcagtgatctacaccattgctgtgctggggaaccttggcatgatcgttttgatttggactcacctccagcttcacactcccatgtatttcttcctcggtaatttgtctgtgatcgacctctgctctgctactgtctttgctccaaggatgctggggaacttctttgcacagagcaaagccatttcctattctgcgtgcctttcccagactttcttttttgttgttttcatcaccacggaggtgttcttgctaacggcaatggcgtatgaccgttacgtagccatctgtagccccctgctctatagcactgttatgaccaagcgagtctgtatgcagttggtggtgggatcatacatggggggactcctgaactcgctgacacacacctgcggcttgctggggctgccgttctgtggccccaatgtcatcaatcattacttttgtgacatccctcccttgctgcagcttgcatgctcggatacccatcgtaatgagactttgctgttagctttctctgcggttattgccctgtttactctctttgtcatcactgcttcctatatgctcatcctatctgtcattctgaagatccagtcagatgatggcaggaagaaaaccttccacacttgtgcctctcacctgacagccatcaccattttctttggatcccttgcttttagctacatccagcccagctccagctactcaatagagcaggagaaagtctcagcagtcttctacacgctcctggtccccatgctgaaccccttgatctacagcctgagaaacaaggaggtgaggagcagcttcagaaggacatttagggtgcgagagcttttccactag
MDGRNESRMTQFILLGLTDGTELQVPLFFIFSVIYTIAVLGNLGMIVLIWTHLQLHTPMYFFLGNLSVIDLCSATVFAPRMLGNFFAQSKAISYSACLSQTFFFVVFITTEVFLLTAMAYDRYVAICSPLLYSTVMTKRVCMQLVVGSYMGGLLNSLTHTCGLLGLPFCGPNVINHYFCDIPPLLQLACSDTHRNETLLLAFSAVIALFTLFVITASYMLILSVILKIQSDDGRKKTFHTCASHLTAITIFFGSLAFSYIQPSSSYSIEQEKVSAVFYTLLVPMLNPLIYSLRNKEVRSSFRRTFRVRELFH
Other categories referring to ORL9432
Revisions: 1
Last Time: 3/21/2008 3:17:58 PM
Reviewer: CC student
Owner: CC student