SenseLab
Chemosensory Receptors
  Data
ORL9433
PREDICTED: Gallus gallus olfactory receptor 3 (cor3), mRNA
atggctttgggaaactgcacaacaccaaccacgttcattctgtctggattgacagacaatccaaggctgcagatgcctctcttcatggtgtttttagtcatctacaccaccaccttgctaacaaatctgggtctgattgcactaatcagtgtggatctccaccttcaaacaccaatgtatattttcctccaaaatctgtctttcacggatgctgcttattctacagtcatcactcccaaaatgttggctacatttttagaagaaagaaaaacaatttcgtatgtaggttgcattctgcagtattttagctttgttttgttgacaacctcagagtgcttgctgctagctgtgatggcatatgaccggtatgtggccatctgtaaacctctgctttatccttccatcatgaccaaggcggtctgctggaggctggtgaaaggtttgtacttcttggccttcctgaactccctggtgcacaccagtggcttgctaaaactatccttttgctcttcaaatgtggtaaaccatttcttctgtgataacagccccctcttccagatttcttcttccagtaccactctcaatgagctgctggttatcatttttggcagcttgtttgtaatgagcagcatcataaccatcctcatctcatatgttttcattattctgactgtggtgaggatccgctccaaggatgggaaatacaaggccttttccacctgcacctctcacctgatggctgtctccttgttccatggaactgtcatcttcatgtacttgcgatctgtcaagctcttctctctggacacagacaaaattgcatctttgttctacaccgtggtgatccctatgctgaaccccctcatctacagctggaggaacaaggaagtaaaggatgctctacgcagacttacagccaccagcatttggcttcactgatccttggtttgtccagtga
MALGNCTTPTTFILSGLTDNPRLQMPLFMVFLVIYTTTLLTNLGLIALISVDLHLQTPMYIFLQNLSFTDAAYSTVITPKMLATFLEERKTISYVGCILQYFSFVLLTTSECLLLAVMAYDRYVAICKPLLYPSIMTKAVCWRLVKGLYFLAFLNSLVHTSGLLKLSFCSSNVVNHFFCDNSPLFQISSSSTTLNELLVIIFGSLFVMSSIITILISYVFIILTVVRIRSKDGKYKAFSTCTSHLMAVSLFHGTVIFMYLRSVKLFSLDTDKIASLFYTVVIPMLNPLIYSWRNKEVKDALRRLTATSIWLH
Other categories referring to ORL9433
Revisions: 1
Last Time: 3/21/2008 3:19:35 PM
Reviewer: CC student
Owner: CC student