SenseLab
Chemosensory Receptors
  Data
ORL9434
Gallus gallus olfactory receptor 3 (COR3b), mRNA
atggcttcgggaaactgcacaacaccaaccacgttcattctgtctggattgacagacaatccagggctgcagatgcctctcttcatggtgtttttagccatctacaccatcaccttgctgacaaatctgggtttgattgcattaatcagcgtggatctccaccttcaaacaccaatgtatattttcctccaaaatctgtctttcacggatgctgcttattctacagtcatcactcccaaaatgttggctacgtttttagaagaaagaaaaacaatttcgtatgtaggttgcattctgcagtattttagctttgttttgttgacagtcacagagagcttgctgctagctgtgatggcatatgaccggtatgtggccatctgtaaacctctgctttatccttccatcatgaccaaggcggtctgctggaggctggtggaaagtttgtacttcttggccttcctgaactctctggtgcacaccagtggcttgctaaaactatccttttgttattcaaatgtggtaaaccatttcttctgtgatatcagtcctctcttccagatttcttcttccagtatcgctatcagtgagctgctggttatcatttctggcagcttgtttgtgatgagcagcatcataatcatcctcatctcatatgttttcattattctgactgtggtgatgatccgctccaaggatgggaaatacaaggccttttccacctgcacctctcacctgatggctgtctccttgttccatggaactgtcatcttcatgtacttgcgacctgtcaagctcttctctctggacacagacaaaattgcatctttgttctacaccgtggtgatccctatgctgaaccccctcatctacagctggaggaacaaggaagtaaaggatgctctacgcagacttacagccacaacgtttggattcattgactctaaggctgtccagtga
MASGNCTTPTTFILSGLTDNPGLQMPLFMVFLAIYTITLLTNLGLIALISVDLHLQTPMYIFLQNLSFTDAAYSTVITPKMLATFLEERKTISYVGCILQYFSFVLLTVTESLLLAVMAYDRYVAICKPLLYPSIMTKAVCWRLVESLYFLAFLNSLVHTSGLLKLSFCYSNVVNHFFCDISPLFQISSSSIAISELLVIISGSLFVMSSIIIILISYVFIILTVVMIRSKDGKYKAFSTCTSHLMAVSLFHGTVIFMYLRPVKLFSLDTDKIASLFYTVVIPMLNPLIYSWRNKEVKDALRRLTATTFGFIDSKAVQ
Other categories referring to ORL9434
Revisions: 1
Last Time: 3/21/2008 3:21:29 PM
Reviewer: CC student
Owner: CC student