SenseLab
Chemosensory Receptors
  Data
ORL9435
PREDICTED: Gallus gallus similar to olfactory receptor MOR172-6 (LOC428828), mRNA
5
atgacagtaatcaatcacaccacagtcacctacttcatcctcttgggactgacagatcgcccagaactacagcctcctctctttgtggtgattctgctgatctatgtcatcaccctggtgggcaacctcatcatgatcagcttgatcacaattgacttccagctgcaaacacccatgtatttcttcctcattaacttgtccatcgtggatctctgctattcttctgtttttattccaaggatgctagtaaacttcttagtggagaataagactatttcttactcaggatgtcttgcccagcatttttcatttgttgtgtttgtgaccacagaaggatttctgctggctgcaatggcttatgaccgctacgtcgctatatgcagcccactgctttataccactctaatggccaggagagtctgtgtttgcctggtagttgggtcatatttagggggactctgtaactcattggtacatacttctggcttactgaaattgtccttctgtggccctaataccatcaaccactttttctgtgacacaaacccgctgctagaactcagttgctctgacaaccatctcaatgagctggtgcttgtaaccctctcagggattgtagctatgtcaacgcttctctttgtcatcatctcctacctctacatcctcttctccgttttgagcatgggctccgcaagcaggtacaaagctttctccacctgtgcctcccatctgacagccgtaacactcttctatgggcctgtgagtttgagccacgtccagcccagttcaagatactcactggaacaggagaaaatttctgcagtattttacaccctggtcattcctatgctgaatcccctgatatacagcctccggaacaaggaggtgaaaaatgcacttagaagagaacggatgataggactaacagtacgaaaaacaaacaaacaaacaaacagtcttctcatctttgtttatttgcttgggttgatgatgataatgattgtattccttcatctttctgacacatttctatcttcctag
MTVINHTTVTYFILLGLTDRPELQPPLFVVILLIYVITLVGNLIMISLITIDFQLQTPMYFFLINLSIVDLCYSSVFIPRMLVNFLVENKTISYSGCLAQHFSFVVFVTTEGFLLAAMAYDRYVAICSPLLYTTLMARRVCVCLVVGSYLGGLCNSLVHTSGLLKLSFCGPNTINHFFCDTNPLLELSCSDNHLNELVLVTLSGIVAMSTLLFVIISYLYILFSVLSMGSASRYKAFSTCASHLTAVTLFYGPVSLSHVQPSSRYSLEQEKISAVFYTLVIPMLNPLIYSLRNKEVKNALRRERMIGLTVRKTNKQTNSLLIFVYLLGLMMIMIVFLHLSDTFLSS
Other categories referring to ORL9435
Revisions: 1
Last Time: 3/21/2008 3:23:33 PM
Reviewer: CC student
Owner: CC student