SenseLab
Chemosensory Receptors
  Data
ORL9434
PREDICTED: Gallus gallus similar to olfactory receptor Olfr152 (LOC428827), mRNA
5
atggaggtaacaattaaaagaaaaaaaatggtccaagataatgataccactgtgactagcttcattctcacaggattaactgatagacaagacctgcagcttccactgtttgctgttttttctttcatttatgggctgactttgctgagcaatctaggaatgatattcatcattaggtttgagccacaactgcatacccccatgtacttcctccttagcagcttgtccttcttagatgtctgctattcttccaccattactcccaacatgctgctcaactttttaatggtgtcaaatggagtgtcgtacagtggatgccttacacagtatggcttctttgcactctttgccaccactgagatgtttctcctggctgcgatggcatatgaccgctacatggccatttgtaacccactgctctacaccgtcattgtgaccagaaaggtctgtgtactgttaatagctggatcgtatttagggggtgctgtgaattctctgatacacaccctgggcttgctaagactgtccttttgcagcttgaatgtcattgatcactttttctgtgatctcatccctctcctaaggctctcctgcagtgacatccaccttaacaagacccttgtctctgtatttggctccgtaattgaggcaaccactcttgcaatcactgtcacttcttattttttcatcattatcacggtgctgaggatccgctctgccaagggcaggcaaaaaacattttccacctgtgcttctcactttacatctgttttcacatttcatggcacaatcctacttatgtacttatgccccagctccagccactcattaggcactgaaaaaattgtttctgtgttctacaccgtggccgttcctctgctcaatcccctgatctacagcttgagaaaccatgatgtgaagtgtgcagcaaggaagctgctgaagaggaaggtctttatgtcctga
MEVTIKRKKMVQDNDTTVTSFILTGLTDRQDLQLPLFAVFSFIYGLTLLSNLGMIFIIRFEPQLHTPMYFLLSSLSFLDVCYSSTITPNMLLNFLMVSNGVSYSGCLTQYGFFALFATTEMFLLAAMAYDRYMAICNPLLYTVIVTRKVCVLLIAGSYLGGAVNSLIHTLGLLRLSFCSLNVIDHFFCDLIPLLRLSCSDIHLNKTLVSVFGSVIEATTLAITVTSYFFIIITVLRIRSAKGRQKTFSTCASHFTSVFTFHGTILLMYLCPSSSHSLGTEKIVSVFYTVAVPLLNPLIYSLRNHDVKCAARKLLKRKVFMS
Other categories referring to ORL9434
Revisions: 1
Last Time: 3/21/2008 3:25:19 PM
Reviewer: CC student
Owner: CC student