SenseLab
Chemosensory Receptors
  Data
ORL9435
Gallus gallus chick olfactory receptor 6 (cor6), mRNA
5
atggcttcaggaaactgcacgacaccaaccacgttcattctgtctggattgacagacaatccagggctgcagatgcctctcttcatggtgtttttagccatctacaccatcactttgctaacaaatctgggtctcattgccttaatcagtatagatctccagcttcaaaccccaatgtatattttccttcaaaatctgtcattcacagatgctgtttattctacagtcatcactcccaaaatgttggctacgtttttagaagaaacaaaaacaatttcatatgttggttgcattctgcagtattttagctttgttttgttgacagtcagagagtgcttgctgctagctgtgatggcatatgaccggtatgcggccatctgtaaacctctgctttatcctgccatcatgaccaaggcggtctgctggaggctggtgaaaggtttgtactccttggccttcctgaactttctggtgcacaccagtggcttgctaaaactatccttttgctcttcaaatgtggtaaaccatttcttctgtgataacagccccctcttccagatttcttcttccagtacagctctcaatgagctgttggttttcatttttggcagcttgtttgtgatgagcagcattataactatcctcatctcatatgttttcatcattctgactgtggtgaggatccgctccaaggagaggaaatacaaggccttttctacctgcacctctcacctgatggctgtctccttgttccatggaacaattgtcttcatgtatttccaaccagccaacaacttctctcttgacaaggacaaaattatgtcattgttctacactgtggtgatccctatgctgaaccctctcatctacagctggaggaacaaggaagtaaaggatgctctacacagagccatagccaccgctgttttgtttcactga
MASGNCTTPTTFILSGLTDNPGLQMPLFMVFLAIYTITLLTNLGLIALISIDLQLQTPMYIFLQNLSFTDAVYSTVITPKMLATFLEETKTISYVGCILQYFSFVLLTVRECLLLAVMAYDRYAAICKPLLYPAIMTKAVCWRLVKGLYSLAFLNFLVHTSGLLKLSFCSSNVVNHFFCDNSPLFQISSSSTALNELLVFIFGSLFVMSSIITILISYVFIILTVVRIRSKERKYKAFSTCTSHLMAVSLFHGTIVFMYFQPANNFSLDKDKIMSLFYTVVIPMLNPLIYSWRNKEVKDALHRAIATAVLFH
Other categories referring to ORL9435
Revisions: 1
Last Time: 3/21/2008 3:27:18 PM
Reviewer: CC student
Owner: CC student