SenseLab
Chemosensory Receptors
  Data
ORL9437
PREDICTED: Gallus gallus chick olfactory receptor 8 (cor8), mRNA
5
atggctgaaggcaacagcacggtggtgagtcagttcgtcctcctaggactgacaggtgagcctgagctgcagactcctctcttcatagtgctctcagtgatttatctcatcaccctgctgggtaacgttgggctgatcacactgatcacgacaagcccccgtctgcacactcccatgtacttctttctctgcaatctatctgttgttgatctttgctactcctctgtcttttctccaaggctgcttattggcttcttgctggataataaaaccatttcctactctgcttgcttcacccagcatttctttttccttgtgtttgtgaccacagaggtgttcttgctggccgtgatggcatacgaccgctatgtagctatttgcaaccccttgctctacactatttccatgcccaagagtctctgcatgaagctggtggctggctcgtacctggggggcattctgaactcactaacccagacatgctgcttgctgcccttgccgttctgtggccccaatgtcatcaaccattacttctgtgacaccaaccctctgctgaaactcacctgctctgacggacgcctcaatgagctcctgctcgtcaccttcaatgggaccatttccatgactgtgctcctcatcatcgtcatctcctatgtgtacatcctcgtctccatcctgagcatcaggtctgccaggggacggcacaaagccttctccacctgtgcctcccacctgctgactgtcaccttgttctacgtgcctgctggcctcagccacatgcagccaggctccaagtactcactggacatggagaaggtcacggcagtgttttacaccttgcttgttcctatgctcaaccctctgatctacagcttgaggaataaggaagtcaaggacacactcaggagagcaagagagagaatattctctcaagctgctcactgcgtactctga
MAEGNSTVVSQFVLLGLTGEPELQTPLFIVLSVIYLITLLGNVGLITLITTSPRLHTPMYFFLCNLSVVDLCYSSVFSPRLLIGFLLDNKTISYSACFTQHFFFLVFVTTEVFLLAVMAYDRYVAICNPLLYTISMPKSLCMKLVAGSYLGGILNSLTQTCCLLPLPFCGPNVINHYFCDTNPLLKLTCSDGRLNELLLVTFNGTISMTVLLIIVISYVYILVSILSIRSARGRHKAFSTCASHLLTVTLFYVPAGLSHMQPGSKYSLDMEKVTAVFYTLLVPMLNPLIYSLRNKEVKDTLRRARERIFSQAAHCVL
Other categories referring to ORL9437
Revisions: 1
Last Time: 3/21/2008 3:31:21 PM
Reviewer: CC student
Owner: CC student