SenseLab
Chemosensory Receptors
  Data
ORL9438
Gallus gallus olfactory receptor 4 (cor4), mRNA
5
atggcggaagggaatcacaccttggcatcagagttcattcttgtgggcctgagtgatcatcccaagatgaaggcagccctctttgtggtgtttctgctcatctacgtcatcacctttcaaggcaatttggggataatcatcctcatccaaggtgaccccaggctccacacttccatgtacttcttcctcagcagcctctcggtggttgacatctgcttctcctccgtgattgcccccagaaccctggtgaacttcctgtcagagaggaggaccatatccttcactggctgcacaggccaaactttcttctacattgtctttgtgaccacggagtgcttcctgctggctgtcatggcatatgaccggtacgttgccatctgcaacccattgctctactcaaccattatgactcgcaggcagtgcatgcagttagtggtagggtcctacatcgggggcatcctcaatgccattatacagacgaccttcatcatcaggctgcccttctgtggctccaacatcataaaccacttcttctgtgatgttcctcccctcctggccctatccttggccagcacctacatcagtgagatgatcctcttctccctagctggcatcattgaactcagcaccgtcaccagcatcctggtctcctacatcttcatctcctgtgccatcctgaggatccgttcagctgaaggcaggcaaaaagccctctccacctgtgcatcccacctgacagctgtcaccctgctctatggaacaacgatattcacgtacctgcggcccagctctagttattccctcaacacggataaggtggtctctgtcttctacacggtggtgattccgatgctgaacccgctcatctacagcctgaggaaccaggaggtgaagggtgctctgagcagggtggtagaaaggatcacagttagggtctga
MAEGNHTLASEFILVGLSDHPKMKAALFVVFLLIYVITFQGNLGIIILIQGDPRLHTSMYFFLSSLSVVDICFSSVIAPRTLVNFLSERRTISFTGCTGQTFFYIVFVTTECFLLAVMAYDRYVAICNPLLYSTIMTRRQCMQLVVGSYIGGILNAIIQTTFIIRLPFCGSNIINHFFCDVPPLLALSLASTYISEMILFSLAGIIELSTVTSILVSYIFISCAILRIRSAEGRQKALSTCASHLTAVTLLYGTTIFTYLRPSSSYSLNTDKVVSVFYTVVIPMLNPLIYSLRNQEVKGALSRVVERITVRV
Other categories referring to ORL9438
Revisions: 1
Last Time: 3/21/2008 3:33:21 PM
Reviewer: CC student
Owner: CC student