SenseLab
Chemosensory Receptors
  Data
ORL9439
Gallus gallus olfactory receptor 2 (cor2), mRNA
5
atgctggttttgtgtttctccgcatctctgctttccaactgcaactgtgttgtgatgatggccaagggaaatcacagctccatcactgaatttgtgctcttgggattctctgaaaagagggccatccaggctgttctctttatgggcttcttgctgatctacctgatcactctgctaggcaatgtgggcatgatcacattgatcaggctggactcccggcttcacacccctatgtacttcttcctgagcagcttgtccttcctcgatatctgctattcctccacaatcactcctcgagtgctctcagacctcccagcatcacagaaagtcatttcccactctgcatgcctggcacagttttatttctacgctgtctttgccaccacagagtgctatcttttggccgcaatggcatatgaccgctacgtggccatctgcagccctctgctctatgtcttctccatgtccagcagagtttgtgtgctgctggttgctggctcataccttgtcggggttgtgaatgccaccattcacacagggcttgcactgcagctgtccttctgtggtcccaacatcatcaatcacttctactgtgacggtcccccgctctacgccatctcgtgcacagaccccaccaccaacgagattgcgatatttcttgtggttggcttcaacatgctcatcaccagcgtgaccatcttcatctcctacacctacatcctgttcgctgtcctcaggatgcacacagctgcaggcaaacgcaaaaccttctccacgtgtgcgtcccacctggccaccgtcaccctattctatgcctctgctggttccatgtactcacggcccagctccaggcactcccaggacctggacaaggtggcctctgtgttctacaccatggtgacccccatgctgaaccccctcatctacagcctgaggaaccaggaggtaaaggatgttttagggaaagtgatggggaggaagagtgtctctgacaaatag
MLVLCFSASLLSNCNCVVMMAKGNHSSITEFVLLGFSEKRAIQAVLFMGFLLIYLITLLGNVGMITLIRLDSRLHTPMYFFLSSLSFLDICYSSTITPRVLSDLPASQKVISHSACLAQFYFYAVFATTECYLLAAMAYDRYVAICSPLLYVFSMSSRVCVLLVAGSYLVGVVNATIHTGLALQLSFCGPNIINHFYCDGPPLYAISCTDPTTNEIAIFLVVGFNMLITSVTIFISYTYILFAVLRMHTAAGKRKTFSTCASHLATVTLFYASAGSMYSRPSSRHSQDLDKVASVFYTMVTPMLNPLIYSLRNQEVKDVLGKVMGRKSVSDK
Other categories referring to ORL9439
Revisions: 1
Last Time: 3/21/2008 3:36:10 PM
Reviewer: CC student
Owner: CC student