SenseLab
Chemosensory Receptors
  Data
ORL9440
PREDICTED: Gallus gallus similar to olfactory receptor Olr202 (LOC428111), mRNA
1
atgccaccatccaaccttaccagcttgatcccagcaacattcgtgctggttggcatcccgggcatggagaagctgcacgtgtggctgtccatccccttctgctccatgtacctggctgccctgctggggaacagcatcctgctgctggttgtgaaggcagagcagagcctccatcagcccatgtacctcctgctgtgcatgctggctgccaccgacttgatgctgtccaccaccaccgtgcccaagatgctggccctcttctggttccacgctggggagatctccttcggcgcctgcctgatgcagatgttcttcctgcactttagcttctcagtggagtccgtcatcctgctggccatggccttcgaccgcttcgtggccatctgccacccgctgcgctacgcagccgtgctgacacccgcagccatcaccaaagtggggctgggggcggtgctgcgcagcttctgcatcatcttcccctgcgtcttcctgctgcggaggctgccgttctgcgggcacagcaccatcccgcacacctactgtgagcacatgggcatcgcccgcctggcctgcgccgacatctccgccaacgtcctctatggcctcgcggtgcccttcgcagccgtcgtgctggatgttgtgctcattgctgcctcctacatcctgattctcctggctgtattcaggctcccatccaggacagcccgctccagggctttcaacacctgcatctcccacgtctgtgttattttccttttctatatccctgcttttttcaccgtgttaacgcaccgctttgggggggaaatcccacaacacgtccacatcctgctggccaacctctacgtgctcttccccccgctgctgaaccccatcgtgtacggggtgcggacgcggccgataagagagaaggtggtgaagatactcctctgccccaccaagcatctgctgcaggaatga
MPPSNLTSLIPATFVLVGIPGMEKLHVWLSIPFCSMYLAALLGNSILLLVVKAEQSLHQPMYLLLCMLAATDLMLSTTTVPKMLALFWFHAGEISFGACLMQMFFLHFSFSVESVILLAMAFDRFVAICHPLRYAAVLTPAAITKVGLGAVLRSFCIIFPCVFLLRRLPFCGHSTIPHTYCEHMGIARLACADISANVLYGLAVPFAAVVLDVVLIAASYILILLAVFRLPSRTARSRAFNTCISHVCVIFLFYIPAFFTVLTHRFGGEIPQHVHILLANLYVLFPPLLNPIVYGVRTRPIREKVVKILLCPTKHLLQE
Other categories referring to ORL9440
Revisions: 1
Last Time: 3/21/2008 3:38:08 PM
Reviewer: CC student
Owner: CC student