SenseLab
Chemosensory Receptors
  Data
ORL9443
X.laevis gene encoding olfactory receptor, partial, clone XR206
  • Xenopus laevis (African clawed frog) Show Other
ggaaacctttcctttgtggacatcagtttcatatctgtaactgtccctctcatggtggcccatcttctcacggacaagaaaagcatatcattcacaggctgcatgacccaactcttcttctttatctggatagctgttctggagtgcttgattctgaccattatggcatatgatcgtctggtggctatcacaaaccctcttcggtatttatctatattagacaggaagacttgctggtctcttataactttctcgtggatattaagctttttgcattctctcctttacgcatccacaatctcttcattggattactgtggtttgaacaaggtcaatgagcatttctgtgatatccctccactactagcactgtcctgctccaaccctgccagcttggaacttcttgtatatactgagggtagtgttatggcaatgagcccctttgtccttatcatggtatcgtatttgcggatcatcaaaaccatattatcgatccactcctcttctggaaggtaccgagcattttcaacctgctcctcccacctgatttctgtagggcttttctttgtaacaatatttgtcagctaccttcagccagcctcagctggagctgttgagacaaacaggccaatagctctggtatattcaatactgactcctctaccc
GNLSFVDISFISVTVPLMVAHLLTDKKSISFTGCMTQLFFFIWIAVLECLILTIMAYDRLVAITNPLRYLSILDRKTCWSLITFSWILSFLHSLLYASTISSLDYCGLNKVNEHFCDIPPLLALSCSNPASLELLVYTEGSVMAMSPFVLIMVSYLRIIKTILSIHSSSGRYRAFSTCSSHLISVGLFFVTIFVSYLQPASAGAVETNRPIALVYSILTPLP
Other categories referring to ORL9443
Revisions: 1
Last Time: 3/21/2008 3:48:54 PM
Reviewer: CC student
Owner: CC student