SenseLab
Chemosensory Receptors
  Data
ORL9463
Danio rerio odorant receptor 9.4 mRNA, complete cds
aaaaaacactgatcaagaacaggtgtaaagtcacagaggaaccaatcctatattcagaaaagtcatatcaggtcaaagatggacaaccagacattccagtacagcatactattagtggagggactgcaagttacatctcaatcaacccttcctacatttattcttcttttgatagtttatgtttttataatggtatctaacattgggatgatgattcagatttcagcagacaaatgtttacaccagcctatgtatgttcttttctgtaacttgacactcaatgatgttttagggacaactgtctttatgccgcatgtactgaagaacttattgaaagacccatctaagtgctatatcacatttgtggagtgcgctattcaagcttattttacacatttgaacggtacagcatctcacactgtgataatgattatggcctttgacagatatgtggcaatatgcaatccactgcgatacccagctataatgaccagtaatatggtggttaaactttcgatagcagcctggggtgttgcagctgtgctggtgggaatattgatcggcctcagtgtgcgtctatcccactgcagatctgtgattcaaggcaacgtttgtgataatgcctcattattcaaactatcctgtgaaaatacagtggttaataatgtatatggattgacttttactgttgttttgtttacctcttcaatagtgtgtgttgcattgacatacctcaaaatagcaatggtatgctttaaaagtaaaaacaaagcaacaaacagcaaagctgtaaagacctgcagcactcacttgactgtttatataatcatgctgatttctggatctgttacaattttccttcatcgttttgttacatacgctgaaactaggaaattagctggtataatatttcatgttattccaccaggcttgaatccaatcatatatggtattcagtccaaggaaataagacaaaagattcttaaactatttagaaatcaagtaaatgcaaagtgattttaatatatttgcatgtttatggtagatctctgtaattacactttctgtgattactaatcagtttatatttatgcagtaaatatactgaaatgtactatagttagtattgcatatacagtgtaaatttctaatattacttcagtaaaataattaagttgcctcctatttatcaatgtatttgcacatttatttaattttgtttgtttatttaaaaaggagaatagtgtcacaagtaagaccactttttaagatcactattaaatgtgcaattaacactataatagtgtatgcctctgtttaaatataagagcatgtacaactttttgtaacaacaatgttaaagcgttctctgcttccaattatttttactgttctatttttttagttcctgctgattgatattgccatctgttatttgttttattattttaatttttattataatataagttatacaaagagtaacacaattagtattactgttacttgtcattcttctagttacttaactttgctattgtatgaaaagtattgcatatttaaagataaaaaccatattattctac
MDNQTFQYSILLVEGLQVTSQSTLPTFILLLIVYVFIMVSNIGMMIQISADKCLHQPMYVLFCNLTLNDVLGTTVFMPHVLKNLLKDPSKCYITFVECAIQAYFTHLNGTASHTVIMIMAFDRYVAICNPLRYPAIMTSNMVVKLSIAAWGVAAVLVGILIGLSVRLSHCRSVIQGNVCDNASLFKLSCENTVVNNVYGLTFTVVLFTSSIVCVALTYLKIAMVCFKSKNKATNSKAVKTCSTHLTVYIIMLISGSVTIFLHRFVTYAETRKLAGIIFHVIPPGLNPIIYGIQSKEIRQKILKLFRNQVNAK
Other categories referring to ORL9463
Revisions: 1
Last Time: 3/24/2008 12:04:06 PM
Reviewer: CC student
Owner: CC student