SenseLab
Chemosensory Receptors
  Data
ORL9508
Ictalurus punctatus olfactory receptor 3 mRNA, partial cds
atggctgataacattacttccattctttcattaacatcaacaaatgcaacatttattcgcccctcaacattttacatcactggactttacaatatcccacatgcaaagtactattatttgtttctttgctttgtgtatactgtcacctttttggggaattcttttataatgggcaccatctacctggcacgcagtttacacacagccaagtacatagctgtcttcaacttggctctctctgatctgtgtggaagctctgctctaattccaaagctcctggacatgttactgtttgagaatcagagtatatcctatgaagcctgtttgtcaaacatgttttttgtttattgctttatgaccctgcaatgtcttactttgcttgctttagcttatgacagactaattgctatatgttatcctttaaggtatcatgctattgttaccaaagcagcaatgattttcattattggtgccatgtgggttctatctgtgagtgtcaatgctgtccttgtagctctaattactagattgtccttttgtagatctacaacagtttatagttatttctgtgatcatggccctatatacaaattagcctgtaatgataataccataaattccataatgggcaatgtctgtactgctaccctgctttactttccattaatactaataattgcctcatatgtttgtattggttttgcattacagaagattgcacatggtgttgagcaagtcaaagctatgaaaacctgcacttcccatcttatattagtggctatgttttatctcccaataattagtgtttatactgtagctcttaccacacgtatagacacaaatatcaggataattaatactgccctgacacaaactattccacccatgttaaacccaatcatatataccttaaagacagaggaggtaatgcaggctattaaattactctacaaacatataaga
MADNITSILSLTSTNATFIRPSTFYITGLYNIPHAKYYYLFLCFVYTVTFLGNSFIMGTIYLARSLHTAKYIAVFNLALSDLCGSSALIPKLLDMLLFENQSISYEACLSNMFFVYCFMTLQCLTLLALAYDRLIAICYPLRYHAIVTKAAMIFIIGAMWVLSVSVNAVLVALITRLSFCRSTTVYSYFCDHGPIYKLACNDNTINSIMGNVCTATLLYFPLILIIASYVCIGFALQKIAHGVEQVKAMKTCTSHLILVAMFYLPIISVYTVALTTRIDTNIRIINTALTQTIPPMLNPIIYTLKTEEVMQAIKLLYKHIR
Other categories referring to ORL9508
Revisions: 1
Last Time: 3/24/2008 3:10:06 PM
Reviewer: CC student
Owner: CC student