SenseLab
Chemosensory Receptors
  Data
ORL9509
Ictalurus punctatus olfactory receptor 32 mRNA, partial cds
atgagtgccttgaactccagtttattacaaaatgtatcatttgtgcgtccagagtactttttcatcagtggattttctggaattcctttcagccaatactattttgcttttttaatttttatctatattatctcactgtgtggtaactcaatagtccttttcatgatattagttgaccgaactctgcatattccaaaatacatggggatttttaatttagcattgtcagactttggtgaaacaaatgtactgattcctagccttgtgaagactttgttttttgattcacagtacatatcctacgatgcttgtttggctaacatgtttcttacttttttcttttctagtggacaggcattaactcttgttgccctggcatatgatcgttttattgccatttgcttacctctgagatacaatgctattgtaaataactccttcatgtttgcaagtttaacagcaatatggatatttaatgttgttatgaatggcacattggtagttttgattacacgactttcattctgtaaaaccaatgagataaagagctttttttgtgaccatgggccagtttatacaattgcttgtaatgacaacagcattaattccttcatggctaagctgtgtactgcagtatacctctatgcaccattgactgctatagtcttctcatacttaggcattctgctggccttaactaagataacaacatgggagagtcgtcttaaagcactcaaaacttgcatctctcacctgttggtagtaggagtgtttttcctacctatagtgggtacgtaccttgctgcagtaactttctctctccatcctaatgctaggataattaatacttcactatcaagaactattccacccatgttaaatcccattatttatgtcttgaacacaaaggatttcagagtctttatagtgaaaatgcttaaaaagaaaaccaccataatttcccaagtgcatgctttagcaaag
MSALNSSLLQNVSFVRPEYFFISGFSGIPFSQYYFAFLIFIYIISLCGNSIVLFMILVDRTLHIPKYMGIFNLALSDFGETNVLIPSLVKTLFFDSQYISYDACLANMFLTFFFSSGQALTLVALAYDRFIAICLPLRYNAIVNNSFMFASLTAIWIFNVVMNGTLVVLITRLSFCKTNEIKSFFCDHGPVYTIACNDNSINSFMAKLCTAVYLYAPLTAIVFSYLGILLALTKITTWESRLKALKTCISHLLVVGVFFLPIVGTYLAAVTFSLHPNARIINTSLSRTIPPMLNPIIYVLNTKDFRVFIVKMLKKKTTIISQVHALAK
Other categories referring to ORL9509
Revisions: 1
Last Time: 3/24/2008 3:12:01 PM
Reviewer: CC student
Owner: CC student